PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G02940.1
Common NameAtMYB107, F13E7.11, MYB107
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 321aa    MW: 36627.9 Da    PI: 6.6732
Description myb domain protein 107
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G02940.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ ++++G g+W++ ++  g++R++k+c++rw +yl
      AT3G02940.1 14 KGPWTPEEDQKLINHIRKHGHGSWRALPKQAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding57.43.5e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eE++ +++++ +lG++ W++Ia +++ gRt++++k++w+++
      AT3G02940.1  67 RGNFTAEEEQTIINLHSLLGNK-WSSIAGHLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-27564IPR009057Homeodomain-like
PROSITE profilePS5129418.763961IPR017930Myb domain
SuperFamilySSF466891.42E-3211108IPR009057Homeodomain-like
SMARTSM007178.0E-161363IPR001005SANT/Myb domain
PfamPF002491.7E-171461IPR001005SANT/Myb domain
CDDcd001672.46E-121661No hitNo description
PROSITE profilePS5129427.39462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.7E-2865117IPR009057Homeodomain-like
SMARTSM007172.2E-1666114IPR001005SANT/Myb domain
PfamPF002492.0E-1667111IPR001005SANT/Myb domain
CDDcd001678.85E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009751Biological Processresponse to salicylic acid
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0009031anatomysepal
PO:0009052anatomyflower pedicel
PO:0001185developmental stageplant embryo globular stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTPE EDQKLINHIR KHGHGSWRAL PKQAGLNRCG KSCRLRWTNY  60
LRPDIKRGNF TAEEEQTIIN LHSLLGNKWS SIAGHLPGRT DNEIKNYWNT HIRKKLIQMG  120
IDPVTHRPRT DHLNVLAALP QLLAAANFNN LLNLNQNIQL DATSVAKAQL LHSMIQVLSN  180
NNTSSSFDIH HTTNNLFGQS SFLENLPNIE NPYDQTQGLS HIDDQPLDSF SSPIRVVAYQ  240
HDQNFIPPLI STSPDESKET QMMVKNKEIM KYNDHTSNPS STSTFTQDHQ PWCDIIDDEA  300
SDSYWKEIIE QTCSEPWPFR E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-30121165108B-MYB
1h8a_C8e-301211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.147340.0root| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible258620_at0.0
Expression AtlasAT3G02940-
AtGenExpressAT3G02940-
ATTED-IIAT3G02940-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB107).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00327DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G02940.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDsalicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G02940
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2493100.0AF249310.2 Arabidopsis thaliana putative transcription factor (MYB107) mRNA, complete cds.
GenBankAY5195830.0AY519583.1 Arabidopsis thaliana MYB transcription factor (At3g02940) mRNA, complete cds.
GenBankBT0256600.0BT025660.1 Arabidopsis thaliana At3g02940 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_186944.10.0putative transcription factor MYB107
TrEMBLQ9LDI50.0Q9LDI5_ARATH; At3g02940
STRINGAT3G02940.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]